PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0167100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 630aa    MW: 67125.3 Da    PI: 5.182
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0167100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS408.94.7e-1251485251373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgd..pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                     lv+ L++cAeav+ gd  la al+++++   +  g+   + ++a yf  AL++rl++         pp +    +  e+ a ++ f+e++P+lkf
  Spipo0G0167100 148 LVHILMTCAEAVQRGDSGLAGALIEEMRPALARVGTrfGIGKVAGYFIDALSRRLYS---------PPHALG-ATARENEALHHRFYEACPYLKF 232
                     689***************************88888645899***************9.........333332.223344445567********** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +h+taNqaIlea++g++rvH++Df+++qGlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+ +g rLa++A+++ vpf f+ ++a+rl+d
  Spipo0G0167100 233 AHFTANQAILEAFDGHDRVHVVDFNLMQGLQWPALIQALALRPGGPPALRLTGIGPPSPDGRDTLRDVGFRLAELAKSVAVPFAFRGVAANRLDD 327
                     *********************************************************************************************** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsles........erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak. 274
                     ++ ++Lrv+p Ea+aVn+v+qlhrll+++ + e         ++++vL  +++l+Pk+v +veqea+hn++ Fl+rf+eal yys++fdsle + 
  Spipo0G0167100 328 VRAWMLRVSPLEAVAVNSVMQLHRLLEDPEEEEAaamaggasPIESVLGWIRGLRPKIVALVEQEANHNKSAFLDRFTEALFYYSTMFDSLEGGs 422
                     **************************766665544555566689***********************************************9887 PP

            GRAS 275 .....lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                          +++ s er+  E+  l+rei+n+v+ceg +r+erhe l++Wr+r+++aGF+p++l+++a kqa++ll+ ++++gy v+e +gsl+lgW++
  Spipo0G0167100 423 rqamgMSPSSGERAAAEAY-LQREICNIVCCEGPARVERHEPLGTWRRRMTRAGFRPAHLGSNAFKQASMLLSLFSEEGYCVDEVDGSLTLGWHS 516
                     8888788888999999988.*************************************************************************** PP

            GRAS 365 rpLvsvSaW 373
                     rpL+s+SaW
  Spipo0G0167100 517 RPLISASAW 525
                     ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.3E-241699IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.7E-1316105No hitNo description
PROSITE profilePS5098563.821122506IPR005202Transcription factor GRAS
PfamPF035141.6E-122148525IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MGGDFGGAGC PAPDIDGLLA EAGYRVRSSD LRQVARRLER LESAMVGEAG PACLGSAAAA  60
AQVIDQQQQM FLAPDAVHYN PSDLAAWVDS MLSEISPSQS SSKVDPCHKV EDDLEGSPPA  120
QVYLEQAAPP SVVAPPPLME EEDSGIRLVH ILMTCAEAVQ RGDSGLAGAL IEEMRPALAR  180
VGTRFGIGKV AGYFIDALSR RLYSPPHALG ATARENEALH HRFYEACPYL KFAHFTANQA  240
ILEAFDGHDR VHVVDFNLMQ GLQWPALIQA LALRPGGPPA LRLTGIGPPS PDGRDTLRDV  300
GFRLAELAKS VAVPFAFRGV AANRLDDVRA WMLRVSPLEA VAVNSVMQLH RLLEDPEEEE  360
AAAMAGGASP IESVLGWIRG LRPKIVALVE QEANHNKSAF LDRFTEALFY YSTMFDSLEG  420
GSRQAMGMSP SSGERAAAEA YLQREICNIV CCEGPARVER HEPLGTWRRR MTRAGFRPAH  480
LGSNAFKQAS MLLSLFSEEG YCVDEVDGSL TLGWHSRPLI SASAWAVNAD ADGPLPGGAD  540
DPNLGALPPP GLPVAPPRQA SNNDHRNYDL LPNDTETGGC DGGDSDHNKS HHPDGNVHSG  600
SSAWSGGSGN AATCSAGSSS NHRSHLRIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-531485254374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008777332.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ84TQ71e-156GAI_GOSHI; DELLA protein GAI
TrEMBLM5WDJ00.0M5WDJ0_PRUPE; Uncharacterized protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-153GRAS family protein